PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT13570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 507aa    MW: 54680 Da    PI: 6.1185
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT13570genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.55e-32180237260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               dDgynWrKYGqK++kgse+prsYY+C++agCp+kkkve++  d++v+ei+Y+g+Hnh+k
  EMT13570 180 DDGYNWRKYGQKQMKGSENPRSYYKCSFAGCPTKKKVEQAP-DGQVTEIVYKGTHNHPK 237
               8****************************************.***************85 PP

2WRKY106.71.2e-33344402159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYY+Ct+++Cpv+k+ver+++d ++v++tYeg+Hnh+
  EMT13570 344 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTPNCPVRKHVERASQDLRAVVTTYEGKHNHD 402
               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.6E-28173238IPR003657WRKY domain
SuperFamilySSF1182901.44E-24174238IPR003657WRKY domain
PROSITE profilePS5081123.594174238IPR003657WRKY domain
SMARTSM007741.4E-34179237IPR003657WRKY domain
PfamPF031061.7E-25180236IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.1E-37329404IPR003657WRKY domain
SuperFamilySSF1182901.96E-29336404IPR003657WRKY domain
PROSITE profilePS5081137.355339404IPR003657WRKY domain
SMARTSM007741.5E-38344403IPR003657WRKY domain
PfamPF031061.7E-25345402IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MAMTPPPSSF PPPSPSSYFN MSSGFLDSSA LLSPSLFASP TTGAFPSHQF NWMGTPENDG  60
LQGSATQDEQ RQYSGFTFQT TAPPPAVTTM ATTSFLQSSM PMAQLVGDSY EQQQQPWSYQ  120
DTGMNGGTRP AEFTTQFEPP TTSTIMATTA PDVLGNGAYS VPVPSGTAGY RVQSRRPSSD  180
DGYNWRKYGQ KQMKGSENPR SYYKCSFAGC PTKKKVEQAP DGQVTEIVYK GTHNHPKPQN  240
PRRGSGSAVS SSYALQCHGA NDASSDALSG TPENSSASYG DDETNGVSSR LAGAVGGGED  300
QFDDEEPDCK RWRSDGEATI MAVGNRTVRE PRVVVQTMSD IDILDDGYRW RKYGQKVVKG  360
NPNPRSYYKC TTPNCPVRKH VERASQDLRA VVTTYEGKHN HDVPAARGSA AAAARYRAAT  420
LQPAAMALQG AGGYSSLRPD GFGGVDGGGA PAEMSGFALS GFGNPSYSYA SMQEQQQQRQ  480
SDAMYYDASR TKDEPRDDMF FGHSLMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-37165405378Probable WRKY transcription factor 4
2lex_A5e-37165405378Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3764820.0AK376482.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3125H17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231268.10.0PREDICTED: probable WRKY transcription factor 33 isoform X2
TrEMBLR7W6L30.0R7W6L3_AEGTA; Putative WRKY transcription factor 33
STRINGMLOC_72586.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-88WRKY DNA-binding protein 33